Mesh Fly Boots Neoprene Stop Orng Large

Keep your entryways clean and clutter-free with this durable rubber boot tray with a woven coir insert, designed for both functionality and style. Crafted from 80% natural rubber and 20% recycled rubber, this eco-friendly tray features a classic scroll design for quick drying and durability. The 100% coir insert, interlaced with stylish dotted patterns, is easily removable for effortless maintenance—just shake, hose, and air dry. With raised edges to contain spills and moisture, this tray keeps your floors protected and organized. Available in multiple sizes, it can comfortably hold 2-4 pairs of adult-sized boots, making it an ideal choice for busy households.

Quality material and looks great!. Morgan. US. Mon Mar 09 2026

The Gunmetal 4 Pair Boot Storage is perfect for closets or any room in the home. The all-metal frame construction has a durable gunmetal gray finish for any decor.

Easy to assemble. Save your wrapping paper tubes, they help keep your boots upright. I also used a rolled up poster board.. Danielle. Alexandria, VA. Tue Feb 24 2026

Nuk3y magnetic screen door is designed to make your life easier with long-lasting performance. Our magnetic screen doors are constructed with heavy-duty fiberglass mesh material. This will provide premium strength that is tear-resistant, more transparency, waterproof, and flame retardant. All hardware is included with instruction on how to install it. Available in a variety of sizes for different size doors.

I measured and purchased 3 screen doors…one double size door and two single doors with built in magnets and put them up by myself in a matter of minutes using Velcro and extra tacks (provided) in my beautiful Green House. No matter how many times I go In and Out of screen doors…it closes every time…I am very pleased with Products, Service and Delivery. Thank You Wayfair !. Millie. US. Thu Apr 09 2026

Say goodbye to mosquito troubles and fully enjoy your gatherings — our high-efficiency solar mosquito zapper is equipped with dual LED lights and a powerful 4500V electric grid, effectively eliminating mosquitoes, flies, moths, and other pests. It supports both solar and USB charging to suit various usage needs. The 3-in-1 design allows for tabletop placement, hanging, or ground staking. Made from durable ABS material with IPX5 waterproof rating, it is EPA-registered and safe for children and pets. Ideal for use in homes, gardens, farms, and commercial spaces.

This is really good I’m ordering another one. Highly recommended. Ramona. Fri May 01 2026

Feature: Easy to disassemble, more convenient. Safety and environmental protection, high fly efficiency.

This worked so well, I’m reordering this year! Way better than sticky paper or any zapper we’ve used. Debby. Brooklyn, NY. Fri May 01 2026

WBM Smart bug zapper racket works to zap most flying insects. Our bug zapper racket is an expert in getting rid of all kinds of big and small bugs. With a pretty look, the zapper is safe and convenient to use as it holds a 3-layer safety mesh that does not allow you to get hurt on unconscious touch. Electric mosquito swatter is not only safe and convenient but also portable. It is a rechargeable zapper with lightweight, which is easy to carry around. You can take our mosquito zapper to camp and use it in the backyard while sitting beside a fire. It has enough power to get the job done with a 1200mAh battery that lasts for a long. Purple light smartly attracts mosquitoes to zap. Our bug zapper is very useful, especially in summer.

I love this it's so great to know that what I buy I can count on. Cindy. US. Sat Jun 27 2026

Spina Boot Scraper is the perfect cleaning tool to have by every door in your house. Heavy Duty, practical and easy to use, this scrubber brush cleans dirty boots and shoes in just a few scrapes. Keep the mess outside and keep your house clean. The hard wood is durable and long lasting. Built-in shoe sole and edge scraper brushes clean off those tough to get at places of mud and manure caked on bottom of shoe. Strong bristle brushes clean mud and snow off boots and shoes. Ideal for every entryway at home, barn, ranch, work, cottage or weekend getaway.

great deal, got one for each entry to the house. We did use concrete screws to keep in place. Lawrence. Long Beach, CA. Wed Apr 08 2026

This black boots organizer rack is designed for storing various boots. The sturdy metal design accommodates up to 10 pairs of boots. The display keeps your boots upside-down which can reduce slouchy or creased boot shafts. This boot rack provides you with a perfect storage solution for boots and reduces damage. The shipping box measures 29.9 inches in width, 19.1 inches in depth, and 3.7 inches in height with a gross weight of 24.9 pounds Overall dimensions are 12.8 inches and 19.1 inches in depth and 55.7 inches in height. The boots organizer rack is equipped with 5 tiers of boot arms, each tier has 4 arms for storing 2 pairs of boots. Each arm is 13.2 inches in length and slanted 40 degrees up. Each tier is 10 inches apart in height, each arm is 4 inches apart in width. Steel structure, manufactured wood base (MDF) This boots rack is made of metal steel powder-coated black. The arms are made of a 0.6-inch tube, the pole is made of a 1.6 x 0.8-inch steel tube. The base is made from 3/4" (18mm) MDF with black melamine finish Versatile use - one-floor display, or 5 independent displays, door mount ready Each tier can be mounted to the wall independently (additional long drywall screw required), or hang the top portion without base over your door (1.6" bracket provided). Each tier of arms can be used separately, so you have 5 boot racks now! Simply drill holes in the wall insert anchors, and fasten arms onto the wall. The top of the boots rack is designed as a hanger for hanging to the door without a base. The top hanger is designed for hanging to the door, the hanger is 1.6 inches in width and fits the door panel with a Maximum thickness of 2 inches.

I really like it. I just wish each hook were about 1 or 2 inches higher from each other. The with is good. Debi. Martinez, CA. Mon Feb 16 2026

This door mat brings clean functionality and a welcoming feel directly to your home. It's crafted from real European beech wood with built-in PVC bristles that work to brush away dirt and debris from shoes. Designed with an open slat construction, it lets particles and moisture pass right through instead of pooling on top. This setup helps maintain a tidy look across the floor. Heavy-duty rubber runners with an anti-slip design line the bottom. It also keeps the mat securely positioned in your indoor or outdoor space.

This is a good door mat for getting mud off of the bottom of your shoes. However, the bristles bend all the way down when you walk on it.. Brandy. Fri Jun 19 2026

Protect, store, and organize your favorite fashion footwear. This product is specifically designed to hang boots in the safest and most space-efficient manner, ensuring your valuable investment is securely protected. The patented design saves space by allowing boots to hang staggered, cradling heel to arch, which doubles the room for storage. Hanger clips are lined with a smooth plastic and rubber blend that will not damage, deteriorate, or leave permanent impressions on boots. The clip is set at a tension strong enough to hold the heaviest of boots, yet gentle enough to avoid crushing the softest suede.

Just buy them they’re worth it they work they’re fantastic. Lauren. Chicago, IL. Wed Apr 15 2026

Barricade Backstop Net：This barricade backstop net is suitable for various ball sports, such as baseball, softball, tennis, soccer, and basketball, and can be used in backyards, lawns, or sports fields. It effectively blocks errant balls. This net can be easily assembled and disassembled in a short amount of time. It features a superior structural design, ensuring it stands firmly on any ground, providing a safe and reliable sports environment.

Great net barrier. Tamara. New Braunfels, TX. Fri Jun 26 2026

Boot scrapper mat made of natural coco fiber weaved into tough galvanized wire, that makes this an excellent all weather mat and helps in scraping dirt and debris off shoes.

Great product! No more mud in the house!. Felicia. Las Vegas, NV. Mon Feb 16 2026

This product will be slightly larger than the door size. Please pay attention to the dimensions you need.

Great screen, love the amount of magnets and durability… was able to easily install on my own and make tight against or around the door. Living in the mountains, we can get a lot of fun critters certain parts of the day…. Jessica. Wrightwood Ca. Tue Jun 23 2026

This antique-style shoe cleaner scraper features heavy-duty iron and tough brush bristles which will get you clean after gardening, working, or hiking. Place the shoe cleanser near your house or car to make your footwear clean. The U-shaped jack aside the brush lets you slide your heel in to make you easily remove sneakers, snow boots, work boots, or hiking boots. Featuring a vintage design, this heavy-duty rustic cast iron boot scraper brings functionality and rustic-inspired style to your home.

Excellent....... well made...... will be of very good use!. Fabiola. Hollywood, FL. Sun Apr 19 2026

DescriptionThis shoe dryer features high-efficiency drying technology that dries your shoes in 360° to keep them dry and comfortable. It comes with a timer function and a simple control panel to easily dry your sneakers, leather shoes, and boots. In addition, the product also comes with a rose saltbox, which can get rid of the odor inside your shoes and bring you a comfortable and refreshing shoe-wearing experience.

It is nice and compact for traveling and does two pairs at a time but if you want fully dry shoes plan on it taking a while in comparison to some other shoe dryers.. Carolyne. Huntersville, NC. Fri Feb 06 2026

Shoe film machine is a new product with strong practicability and wide application range. It is not only suitable for families but also widely used in hotels, real estates, hospitals, computer rooms, exhibition halls, factory dust-free workshops, animal and plant cultivation research sites, etc. Ground.This product does not require a one-cut power supply, safe and reliable, exquisite shape, no need to take off shoes, membrane replacement is simple and convenient.

Anonymous. Wed Feb 19 2025

Rubber-Cal, Inc "Herringbone" shoe scraper mat is a fun front door or mud room accessory made with 100% natural coir fiber. This environmentally friendly coco mat scrapes dirt, mud and snow from shoes as a natural way of keeping your home floor clean! Its natural coir fiber color is a subtle accent for any home doorway. Simply shake, brush or vacuum boot mat for easy cleaning!

Love this couch! It’s attractive and comfortable. It took two of us about an hour to assemble it. Everything was provided but a page was missing from the instructions and it had a duplicate of another page.. Cindy. Mount Vernon, IA. Mon Feb 24 2025

Let fresh air in while keeping bugs out with the One Car Garage Magnetic Screen Door by Pure Garden. This handy mesh curtain is an effective and cost-conscious way to convert your garage into a screened-in porch so you can enjoy cookouts, parties, or just a relaxing evening outdoors with added privacy and protection from insects such as mosquitos. This mesh screen door is heavy-duty, built to last, and installs in minutes with an innovative hook and loop mounting system that is easy to remove for convenient storage.

I use this screen on my back porch. I love that it protects us from the mosquitos, flies and other insects. Good protection from the sun while letting the breeze pass through.. Tonnetta. Pensacola, FL. Sun Jun 14 2026

With the spring-loaded design, their Boot Shaper provide tension for all types and style of boots. They help prevent cracks and creases in leather and vinyl boots. They not only protect your boots but also help to get your closet organized.

Love. Have used these for several boots now.. Kathleen. Henderson, NV. Tue Jul 07 2026

Laundry 360 active wear wash bag set is the perfect way to protect your high-performance gear. After a long, hard workout drenched in sweat, all you want to do is take off those nasty clothes and get them washed. With this wash bag set, shrinking, stretching, fading and snags will be prevented while helping keep your clothes looking newer and longer. With antimicrobial micro mesh and circulation throughout the bag, your clothes will be clean and remain fresh. If you feel the need to keep certain clothes separated by color, the activewear wash bag set is perfect for safely separating colors.

Very strong material good size and the plastic zipper is definitely a plus. Jean. Boynton Beach, FL. Sun Jul 05 2026

Offering a simple solution to the problem of storing and keeping tall boots crease-free, this 6-pair black metal boot stand stores boots in an inverted position, ensuring boot shafts are kept straight and boots are neatly arranged. Perfect for placement in your entryway, mudroom, closet, or garage, the rack's durable metal construction ensures that this sleek storage rack will last you a lifetime. SPECS: Overall - 25.0 W x 8.0 D x 18.5 H; Front Posts - 14.5 H; Rear Posts - 18.5 H; Space between posts - 5.5 W (in inches).

Slightly better quality that I expected, but I hadn’t thought about the balance of it. We use it for our boots around the property and once it’s out of balance (one pair) it topples over. Not a huge issue. I drilled some holes and anchored it into the concrete. It would be nice if it came with holes, or some type of weight to avoid anchoring it.. Brianne. San Luis Obispo, CA. Thu May 07 2026

This decorative boot rack is a good solution to organize, store, and cleaning boots. It is supplied with a scraper in the middle and has four poles that can hold two pairs of boots, At the top of the rack you can also hold smaller items. The underside comes equipped with four rubber feet to prevent scratching of the floor. These decorative cast iron parts have each been hand cast according to age-old tradition and craftsmanship.

had this on my wishlist for a year & finally pulled the trigger :) make sure you check your dimensions & you won't be shocked by the size (the image makes it appear larger than real life, imo) sturdy & easy to assemble, pretty intuitive - thank goodness bc the instructions are laughable. Amelia. Madison, WI. Mon Oct 12 2020

Add charm, personality, and practicality to your doorstep with our collection of Papilio Utility for coir doormats. Made from durable, natural coconut fibers, these eye-catching mats are designed to keep dirt outside where it belongs—while giving your guests a warm, cheerful welcome from the moment they arrive. Whether you're looking for a playful welcome message, a seasonal motif, or a pop-culture reference, we’ve got something for every personality and style. From witty sayings to colorful patterns, these funny coir doormats are perfect for entryways, patios, porches, and mudrooms.

I am in LOVE with my big door mat!!. Emily. Mon Jun 08 2026

Upgrade your standing experience with A1HC Rubber Stud Mat for Kitchen, Restaurant, Business, and Industrial areas. Enjoy long-lasting comfort and relief indoors or outdoors. Functionality, durability, and style for clean, safe, and sophisticated entryways. Enjoy long-lasting comfort and relief.

Love it.. Anonymous. Tue May 12 2026

Enjoy the outdoors without worrying about bug bites or applying chemical repellants with the 4000V Detachable Bug Zapper. This powerful electronic Insect Killer gets rid of any flying insect before they get a chance to get you. It's safe. It's easy. And it's energy efficient. Take back your home from annoying insects and zap your bug problems away, 24 hours a day. The insect killer lamp has a high-intensity bulb for increased lure capacity that's easy to remove and replace. It also features lantern styling to blend in with most outdoor settings. Unit should be placed 25 feet away from human activity and hung 6-8 feet off the ground from the hanging ring for optimum performance. Our Mosquito Killer is your gatekeeper to enjoying your backyard and patio bug free.

It is doing it job effectively. Linnie. Concord, GA. Sat Jun 20 2026

10/12/14/16in Boot Shaper Form Inserts Boots Support for Girls Women Boot Reduces boot bending, cracking, and crumbling, and maintains its natural shape.

They work ok. Just took a long time to receive.. Nadezhda. US. Mon Mar 02 2026

Works well, gave it to my son for his backyard deck. Patricia Costello . Carrollton Texas. Fri Mar 20 2026

Our insect screen door features a design combination of magnetic long strips and small pieces, making it easier to close automatically and leaving no gaps. Hands full? No problem, just walk through - the self sealing magic mesh screen door will close behind you. No need to constantly open and close the door for dog and kids. When frequent access is needed, buckles on both sides can keep the temporary screen door open.

Keep entryways spotless with this dark coffee cast iron heavy duty entryway doormat shoe scraper, designed for outdoor durability. The angled design enhances efficiency, while stiff bristles and a dirt cleaner brush remove mud and debris with ease. A built-in boot puller/outdoor boot mud brush provides extra convenience, making it perfect for cleaning footwear. Crafted from weather-resistant cast iron, this sturdy shoe scraper adds rustic charm to any front door mat setup.

So glad we decided on this shoe scraper. It looks great and functions well. Quite sturdy and heavy, you can wipe your shoe without it moving. Big plus is the oil rubbed bronze finish and design.. Lisa. CA. Tue Mar 10 2026

Leave the dirt and muck outside where it belongs when you use this Rubber Boot Scraper. Rubber fingers brush mud and leave off your boots, then the Scraping Mat can be hosed when dirty. Durable rubber construction and a generous size can handle thick, heavy work and muck boots. Leave 1 outside the door at home, with the RV or tent when camping, or at the office and job site to keep the mess outside and off your interior floors and carpets.

Very affective and holds up to inclement weather. Stays put through strong winds!. Terry. Dekalb, TX. Sun Sep 18 2022

TheCollapsiblePortableIndoorTripodClothesDryingRackistheperfectenvironmentallyfriendlyalternativefordryinglaundry.Thisthoughtfullydesignedindoorfoldingtripodhangingrackisdesignedtomakeairdryingyourclothesabreeze.Craftedwithasturdysteelframeandarms,thisrackprovidesamplestrengthandstabilitytoholdeventheheaviestofitemslikewettowelsandjeans.Itshangerslotscanaccommodatehangerplacementthroughandatoptheprovidedholes,ensuringyourclothesaredrywrinkle-free,andwithoutanymarks.Measuring64.5inchesHx26inchesindiameter,thisdryingrackprovidesamplespacefordryingafullloadoflaundry.Whennotinuse,itfoldsanddisassembleseasilytostoreinaclosetorsmallspace.Itssilverandbluecolorschemeaddsatouchofmodernstyletoyourspace,whileitscleverdesignmakesiteasytouseandmaintain.

This is the second one I bought. They are great for their purpose, drying the laundry that can’t go in the dryer. The first one I had collapsed under the weight of too many pairs of jeans and had to be replaced after a few years of use. The second one is a bit tricky to open close but I still highly recommend it.. Carol. Post Falls, ID. Mon Jun 15 2026

Give your small breed companion the ultimate travel experience with the HazooWill Pet Travel Carrier. Specifically designed for Toy Poodles, cats, and small dogs up to 25lbs, this car seat features a non-slip base that keeps even the wiggliest pets secure during the ride. Crafted with thick, durable, and warm fabric, it provides superior comfort in any season while resisting hair and wear—making it perfect for daily use. The hair-resistant material wipes clean instantly after muddy paws or car sickness, saving you time and effort. With a simple 4-step assembly—thread the seatbelt, adjust the straps, lock the buckles, and go—you'll be ready for the road in seconds. Best of all, it seamlessly transitions from a car seat to a cozy indoor bed, giving your pet a familiar, comfortable space wherever you are.

My puppy still isn’t used to car rides. He gets motion sickness and usually throws up if the trip is over an hour, so I got him this car seat, and it has made a big difference. He really likes it. I especially love the front and back cushion design. It feels very secure and cozy for him. It also comes with a safety tether that clips onto his harness to keep him from jumping out. It’s very versatile too. Not just a car seat, it can also be used as a dog bed at home and as a shoulder carrier when going out.. Leila. Sun Mar 29 2026

Product Description:Supple, padded unit effectively stops drafts under any standard window or door. The exterior fabric is made of tightly woven Nylon. The fill is Foam and can be cut to measure any size door or window. The Draft Stop is 36-inches long with exterior fabric made of tightly woven synthetic fleece and satin trim. It includes a woven satin handle for convenience. The fill is a nylon fiber and weighted with cotton bags filled with ground stone. The draft stop can be used on most doors and will slide with the door when it is opened and helps keep energy costs down.

This draft stopper solved my problem perfectly. I live in an apartment and it keeps my air and heat from escaping into the hall. It also protects my privacy by keeping my conversations contained in my space. It also keeps the noise from the hall out. It is a very affordable solution.. Rosanna. West Baden Springs, IN. Mon Jun 01 2026

20W Electric Bug Zapper Outdoor, 4000V High Power Mosquito Attract Light, IPX4 Waterproof Fly Zapper, for Backyard Garden Patio Farm, 1/2 Acre Coverage

Say goodbye to annoying flying insects with the Liba Indoor Zapper, a powerful and chemical-free device designed to eliminate flying pests from your home or workspace. Equipped with four high-voltage lightbulbs, the zapper naturally attracts and instantly eliminates any flying nuisances, keeping your environment clean and comfortable. Whether you’re dealing with flies, mosquitoes, or moths, this zapper gets the job done efficiently and quietly. The included safety screen ensures that small fingers stay safe from the device, making it a perfect choice for homes with children or pets.The Liba Indoor Zapper is easy to set up and use, with a convenient on/off switch and a five-foot cord for flexible placement. Hang it up with the included chain, or place it on a countertop or table in high-traffic areas. It’s an ideal solution for kitchens, hospitals, offices, and restaurants. No harmful chemicals or sprays are needed, just the power of light to attract and zap flying insects. Plus, with four bonus replacement bulbs, you can keep your zapper working like new for longer. Cleaning is a breeze with the removable tray, making maintenance simple and hassle-free. Keep your indoor spaces bug-free with the Liba Indoor Zapper!

Worked perfectly just like they are suppose to. David. CA. Sat Mar 21 2026

Cast Iron Cute Frog Door Stop - Heavy Duty No-Drill Floor Door Wedge, Vintage Iron Decor for Patio, Yard, Garden & Farmhouse Home/Office/Commercial Use

Just place up against door and come and go as you need. Best to place a round foam pad under little feet to give additional tilt to press agents door.. Ron. Phoenix, AZ. Sun May 10 2026

The Attract® Magnetic Wreath Hanger is specially designed for metal doors and single-pane glass windows. It is the perfect alternative for traditional over-the-door style hangers. The backside of these magnets has soft padding to protect the door or glass from scratches and hold up to 10 lbs. Set of 1 works on most metal surfaces and the Set of 2 can be used on most metal surfaces or together on single pane glass.

Used daily to hold my double door wreaths.. Nancy. Altamonte Springs, FL. Mon Jul 06 2026

Say goodbye to mosquito troubles and fully enjoy your gatherings — our high-efficiency smart mosquito zapper is equipped with lights and a powerful 2800V electric grid, effectively eliminating mosquitoes, flies, moths, and other pests. It supports both solar and wire charging to suit various usage needs. The 4-in-1 design allows for tabletop placement, hanging, wall-mounted or ground staking. Made from durable ABS material with IPX5 waterproof rating, it is safe for children and pets. Ideal for use in homes, gardens, farms, and commercial spaces.

The unit itself seems to be high quality. The solar charging feature works nicely and the cord charger is a nice option. However, the wall mounting bracket is a bit flimsy and I am concerned about its longevity. Kristen. US. Mon Jul 06 2026

Ensure your boots, shoes, and sneakers remain in pristine condition with our highly versatile all-weather industrial boot brush scraper. Crafted with a built-in edge scraper and a powerful scrub system, this shoe cleaner is designed to effectively tackle the toughest mud, dirt, and debris, making it an essential tool for maintaining clean footwear. Constructed from durable steel and hardwood, it features strong bristle brushes that provide a deep, thorough clean, ensuring your footwear is spotless and ready for any environment. What sets this boot scraper with brushes apart is its portability whether you need it on the farm, at home, in your truck, or at your business, you can easily move and position it wherever it's needed most. Its portable design allows you to bring it along for quick and convenient cleaning on the go, making it ideal for high-traffic or outdoor areas. Despite its robust construction, it's easy to install, giving you hassle-free setup in any location. This boot scrubber is suitable for all types of footwear and designed to withstand all weather conditions, making it perfect for year-round use. Keep the mess outside and ensure your living and working spaces remain clean and tidy with this reliable and efficient solution. Whether you mount it for a more permanent setup or move it from one place to another, this scrubber offers unmatched convenience and practicality for any environment.​​

When it rains, our yard gets up to 4 of deep, sticky mud. This boot scraper works great at removing built up mud from boots and shoes. It attached easily to a small piece of plywood that we can move to where its needed. Our interior entryways are now mud free and the house stays much cleaner.. Lisa. Grants, NM. Sun Feb 22 2026

Available in 50 piece sets, these fruit protection bags are crafted from high-quality non-woven fabrics, featuring a white design and 11.8x7.8inch (30x20cm) size with a convenient drawstring. Reusable and breathable, they effectively shield grapes and other fruits from bugs, birds, and damage. Perfect for home gardens, they keep fruits clean and intact, ensuring a healthy, high-yield harvest with minimal effort.

Tired of flies on the wall? Transform your mason jar into a sleek fly catcher. Stop crowding your kitchen with unpleasant sticky hangars or cumbersome traps, simply slide this lid attachment onto your mason jar and let it do the job without sacrificing counter space or aesthetics.

Works great on standard mouth canning jars and come with a recipe for attracting fruit flies.. Joshua. Prineville, OR. Sun Jan 05 2025

Shoe film machine is a new product with strong practicability and wide application range. It is not only suitable for families but also widely used in hotels, real estates, hospitals, computer rooms, exhibition halls, factory dust-free workshops, animal and plant cultivation research sites, etc. Ground.This product does not require a one-cut power supply, safe and reliable, exquisite shape, no need to take off shoes, membrane replacement is simple and convenient.

My family and friends love this items, it's practical easy not to common. Ludmylla. Norton, MA. Fri Mar 28 2025

Covers & All Magnetic Screen Door, Made of 6 Oz Black Mesh Resistant to Abrasion (32" W x 80" H)

I have bought several of these over the years for garage entry I just bought my last would definitely recommend. Phillip. US. Mon May 18 2026

The GoSports 20' x 10' barrier net is built from premium materials to provide a versatile barrier net for a variety of applications. The most common uses are as a barrier net for sports to prevent balls going into unwanted areas, such as a baseball backstop, behind basketball hoops, field boundaries and countless other uses. The commercial grade polyester netting is designed for balls greater than 2.5 inch in diameter, so they work for all the major sports such as baseball, softball, lacrosse, tennis, football, basketball and more. They however will not stop smaller balls such as golf balls. This net size makes it perfect for team or individual use. The net includes 4 robust metal stakes so it can be staked into grass or dirt, along with sandbags to place on the frame for added stability.

These nets are perfect to line our backyard!! Hold up well through the winter too.. Kristina. Oswego, NY. Mon Jun 30 2025

Reinforced magnetic door screens are made with thickened reinforced Mesh(≥250g/m²), it's much stronger than other Fiberglass or polyester (Only 120g/m²)mesh screen doors. Our thicker reinforced mesh has a tough texture, high tensile strength. it's scratch resistant and tear-proof. Can as pet screen door,No need to worry about being scratched by pets.If your door frame measures 36" or less in width and 80" or less in height,then this retractable screen door will be the fit. Important: Measure your door before ordering to be sure our door mesh screen with magnet will fit. See all available sizes to order theF size for YOUR door opening.