Conair Babnt053t Blue Travel Dryer Nano

Free yourself from clunky corded mirrors and stay gorgeous anywhere you go with this rechargeable beauty essential. Shine a light on your looks no matter where you are with the convenience of the Rechargeable Compact LED Lighted Mirror from the Unbound® collection by Conair®.With the touch of a button, your face is bathed in light cast evenly from a ring set around the mirror. Reveal the most minute facial details as you apply or touch up cosmetics, tweeze fine hairs, put in contacts, check your hair, or perform any task that requires a close look and clear view. Designed with the latest advances in LED technology, the built-in light provides a boost of brightness that's made to last a lifetime, so dimming, burned out, and dead bulbs that need replacing are finally a thing of the past. With a battery that's fully charged, you can now rely on light that's ready to shine whenever you are!The easy-to-use USB cable is included so you can keep the battery charged no matter where you are. Simply plug the portable cable into any USB wall charger, computer port, or car adapter to give the light a boost. The fully charged battery will power the LED light for up to 3 hours, so it's always ready to shine no matter how often you check your look or how long you take to create your style. (Note: Before your first use, completely charge the battery overnight.) The compact mirror also offers dual magnification, giving you the option of a 1x standard view to see your features in their actual size or 3x reflection that zooms in on the finer details of skin and hair. Partnered with the LED light ring, close-ups are made brighter and offer greater clarity.Perfect for travel, the contoured compact mirror is shaped to slide right into a bag and small enough to save space and be unobtrusive. The outer casing and hinged, snap-to-close lid are crafted from durable plastic that protects the light and mirror from damage and scratching, and the tapered edge fits just right in the hand for a slip-free hold. For an illuminated reflection you can take anywhere and use day or night, the lighted mirror is the ideal beauty companion.

love this mirror can put in purse for makeup checks on the also the light illumminated me for more perfect toucups. Jasmine. Laguna Niguel, CA. Thu Jan 11 2024

With a powerful brushless motor, the InfinitiPRO by Conair DigitalAIRE Hot Air Brush delivers 1200 watts of superior drying power without heat damage thanks to ceramic technology that evenly distributes heat. Four different attachments make it easy for you to totally personalize your look. Use the curling wand attachment to add body and waves to hair, create a soft blowout with gorgeous volume that begins at the roots with the 1¼" round brush, smooth and shine hair with the paddle brush, or simply dry and style with the drying nozzle attachment. Choose from 3 temperature settings (cold, warm, hot) and 2 speed settings (high, low) for customized styling, then hit your hairdo with a shot of cool air to lock it in. Experience superior drying power and easy styling with this 4-in-1 styling dryer that lets you personalize your look. Designed with dynamic performance and engineering, this hot air hair styler creates the latest looks from sleek and shiny to classic curls.

I am OBSESSED with this hot tool, the brush is my new favorite thing to use on my hair. It smooths and dries and is soooo nice on my hair. The attachments are all perfect, and the option for cool to hot is fantastic. Conair is simply the best.. Gcamp22. Sat Apr 04 2026

Get the smooth, straight styles you love with a flat iron that leaves your hair shinier and healthier-looking every time you use it. The SmoothWrap Dual Ion Flat Iron uses Advanced Plasma Technology for a new styling experience that rebalances the natural charge of your hair for maximum frizz-free shine and volume so that your hair looks and feels amazing. Designed with ceramic technology to minimize heat damage, the 1-inch plates with curved edges glide over hair for a smooth finish with no creases, while a powerful ion generator neutralizes frizz. You can hear the clicking sound as frizz-fighting ions are released to ensure exceptionally high shine. Five heat settings give you the flexibility to switch up your styles with customizable heat for any hair type. The SmoothWrap Dual Ion Flat Iron features breakthrough technology for head-turning results. The difference is Advanced Plasma Technology, which wraps your hair in positive and negative conditioning ions to create the perfect balance. Frizz is neutralized, body boosted. The treatment maximizes your hair's absorption of conditioning ions, leaving it feeling moisturized and silky smooth. This versatile tool with easy-glide, ceramic-coated plates lets you straighten, add flips, and create waves without having to worry about heat damage. Explore endless styles and change the temperature setting at the touch of a button to match your hair type. A floating plate provides better hair contact to eliminate gaps for a faster, straighter finish. Style like a pro quickly and easily with the new treatment that leaves your hair looking and feeling more healthy and with shine that turns heads!

[This review was collected as part of a promotion.] I use a straightener mostly everyday for my front pieces and baby hairs and to fix some weird pieces that need to be smoothed out and straightened. I have very thick wavy hair so sometimes it's hard to find something that works effectively for me. This straightener is nice because it definitely adds shine and helps with frizz. The ceramic plates definitely make a difference. There are five settings and I use setting four, but don't feel like I'm damaging my hair doing so. The one con I have is the cord is extremely thin and flimsy and I can see this ruining the lifetime of the iron.. Jdoski. Providence, RI. Fri Nov 10 2023

SALAV's HS-15 Quicksteam Travel Steamer is a portable but powerful device with 1000 watts of strong steam and a quick start of just 10 seconds! It has a stainless steel steam plate and a unique brush creaser attachment that helps create creases on fabrics while removing unwanted lint at the same time. What's in the box: HS-15 Quicksteam Travel Steamer, Brush Creaser Attachment, Water Cup

Purchased for my husband. He said it was perfect and great for travel. Would highly recommend.. Barbara. Custer, SD. Fri Jan 23 2026

Reveal your style with the Rowenta Pure POP Handheld Garment Steamer. The garment care solution that takes fabric care to a new level. This handheld steamer is intuitive, fast and efficient, refreshing and steaming your fabrics in one simple, smooth movement. The unique reversible pad system switches effortlessly between a velvet side for steaming without any risk of damage—even to the most delicate textiles—and a lint remover side that refreshes clothes and keeps you looking your best. Rowenta PurePOP is ultra-compact, slim and lightweight to go anywhere you need it—for effortless storage and great for travel. The lightning-quick 15-second heat-up time, ideal for frequent use and last-minute touch-ups.

super nice i think it is going to do the job i bought it for. Rebecca. Grand Rapids, MI. Wed Feb 26 2025

Are you bothered by the fact that your clothes are always not dry or smelly in the wet weather? Then you definitely need this folding remote control dryer. It has over-temperature protection so you don't have to worry about any safety hazards of forgetting to turn it off. It works at less than 45 decibels and won't disturb your work or rest when it's running. In addition, it also has an intelligent remote control, which makes operation easier and more convenient.

The thinner poles don’t line up but otherwise works for my needs.. Joy. US. Sun Apr 27 2025

"The Bi-Ionic High Speed Hair Dryer combines Bi-Ionic Technology (dual ions to eliminate static & frizz) with an 110K RPM motor for professional-grade speed. Its Spiral Air Duct (Mera’s patented design) reduces hair tangling while maximizing airflow.In Safe Mode, it delivers gentler heat for sensitive scalps; the Self-Clean mode uses reverse airflow to prevent clogs and maintain long-term performance.This hair dryer operates at a conversational volume—similar to the sound level of normal conversation—making it comfortable for everyday use without disrupting your focus. The Multi-Color Heat Indicator simplifies temperature settings, while its 152 mph airflow speeds up drying without sacrificing safety or comfort. Whether for daily use or professional styling, it brings salon-quality results effortlessly."

Enjoy smoothies on the go with this personal blender! Featuring a safety locking system and single-touch operation, this blender is perfect for whipping up your favorite blends. The convenient travel cup allows you to take your smoothie with you wherever you go.

Great portable blender. Rosemary. MI. Thu Jul 02 2026

Meet the Ninja Blast Max - the performance of a corded blender now cord free. Blend, Twist & Go from virtually anywhere while powerfully blasting through ice and frozen fruit with Ninja blending power. Achieve pulsing and processing power through 3 new intelligent Auto IQ programs. Blend, crush and smoothie. Plus, with one simple twist you can remove the vessel for ultra portability, lighter carrying, and convenient sipping.

Love this blender! It makes delicious smoothies.. Kathryn. Havertown, PA. Wed Jul 01 2026

The Caynel Mini Fridge is an eco-friendly "green" product, cooling and warming using advanced semiconductors that are free of CFCs and refrigerants. Enjoy the many benefits of the cooler/warmer, while protecting the safety of the environment. Its 4.2 Quarts (4 Liters) capacity can keep up to six cans. The ultimate versatile cooler, this mini fridge goes from cooling to heating with just the flip of a switch. Cools down to 32° F and warms up to 140° F. It is insulated, ensuring that your food and beverages, stay cold and warm, making this product great for use in a car, home, boat, office, or any other mode of transport. Its small size, sleek design, and convenient carry handle, make it easy to take the mini fridge with you on the go!

I liked it, it just didn't really fit my space. The cord sticks out. I also wish there wasn't a logo on the front. And that the door actually latched.. Clare. Detroit, MI. Tue May 12 2026

Samsung's large-capacity smart gas dryer is equipped with the pet care dry cycle that helps remove 97% of 3 unpleasant pet odors. Steam Sanitize+, which removes 95% of pollen from fabric, while multi-steam refreshes clothing and relaxes light wrinkles. With Wi-Fi connectivity, you can remotely start, stop, or delay your dryer from our simple-to-use smart things app.

Shame on me…I didn’t read the entire description but I thought I was buying the washer/dryer set. All the pictures show them together. Even when it showed my cart and what was being delivered, it showed the set. So when the delivery guy showed up with just the dryer, I was disappointed.. Lawanda. Spanish Fort, AL. Thu Feb 06 2025

Still, worried about washing clothes? Get a washing machine and free your hands! Designed with one of two tubs for washing with a 19 lb. capacity and the other for spin drying with an 11 lb. capacity. The portable washing machine brings a lot of convenience to your life. This compact washer and dryer combo runs on 110v power and has a spin speed of 2000 RPM. features a pump drain! Even though your washer is on a higher level, you don't need to worry about drainage at all. This double-drum washing machine has individual time controls and is very easy to operate. You can also choose how much water you want to fill it with. This mini washing machine is not only eco-friendly but also energy and water-efficient, saving your family money by saving up to 84% on energy consumption compared to similar models. The compact and lightweight design makes it easy to install in your bathroom or closet. Our 2-in-1 portable washing machine features labor-saving operation and labor-saving design. Don't hesitate to add it to your cart!

Initially purchased for a temporary solution until my actual washer was available for purchase. Used this little guy for one day and it washes well. We used buckets to fill and drain since it was placed in my laundry room. I wish the spin dry was a tad larger, but that’s my only complaint. Overall great purchase.. Lashonna. US. Sat Feb 28 2026

This washcloth towel set brings effortless functionality to your home. It's woven from pure cotton with a 520 GSM weight, offering a substantial yet soft feel against the skin. The fabric features looped yarns that maximize absorbency, making it easy to refresh your daily routine. Designed to resist fading, low linting, and pilling, this set maintains its fresh appearance over time. A decorative dobby border completes each piece with a classic, tailored finish. Plus, it comes as a 6-piece bundle so you can keep your space fully stocked.

I absolutely love these wash clothes. They are great quality and a perfect price point. I purchased them for our guest bathroom and cant wait to use them.. Denese. US. Thu Jun 04 2026

Cook crispy fried food in a dash with this air fryer, with hot air instead of oil, for delicious fried food with up to 75% less fat than a traditional deep fryer. The redesigned air fryer allows you greater surface area inside, so food gets crisper, faster. With a single temperature of 400°F, just set the time and get cooking! Perfect for cooking frozen treats like chicken nuggets, fish sticks, and other snacks, this is a compact air fryer that families will love.

Awesome air fryer.. love the size of it.. Evelin Vargas. Bronx, NY. Fri Mar 20 2026

Could not be happier with this dryer and it looks great.. Alicia. Reno, NV. Sat May 09 2026

Ironing boards are often fiddly to set up and difficult to store away. Pocket, however, breaks the mold. We designed our revolutionary table-top ironing board with exceptional storage capabilities and uncompromising functionality. When not in use, Pocket folds in half for easy storing and even has an integrated storage compartment for the iron.

Love it, super practical for my laundry room.. Anonymous. US. Sun Jan 11 2026

Are you still worried about cleaning your car? Our car dryer can solve your problem. The high-class material makes it sturdy and durable. The pure copper motor can provide strong power. Its lightweight(2.87 lbs) makes it easy for you to carry. Adjustable wind speed can meet your various cleaning needs. Anyway, it's your cleaning assistant!

Samsungs Bespoke ultra capacity electric dryer has a sleek, flat-panel design, comes in new premium colors, and is equipped with smart features that simplify your laundry experience. It has our super-speed dry, which optimally dries a full load in just 30 minutes, and our AI smart dial, which learns and recommends your favorite cycles and makes controlling your dryer a breeze.

Bought this as a set for my mom and she loves it. Bryan. Tue Jan 13 2026

Our portable washing machine with twin tub design, wash and spin simultaneously. Comes with 1 drying rack & 10 hangers. Three knobs make it easy to operate, even for seniors. Each cycle is super fast, saving you time. Compact size fits any space, no installation needed. Energy and water efficient, with durable plastic body preventing rust.

It’s smaller than I imagine but it does the job well.. Anonymous. Wed Jun 24 2026

A great manual laundry dryer is the ideal choice for your convenient life. It adopts a manual rope-pulling operation to generate strong centrifugal force to remove most of the moisture from clothes, greatly reducing the time required for drying. The compact and lightweight design is easy to move and store. Whether it's to improve laundry efficiency or meet the needs of outdoor activities, this dehydrator can provide significant assistance, allowing you to enjoy a more relaxed laundry experience.

If the clothes are balanced in the machine, water can be taken out efficiently. However, the squeezed water will not flow well naturally unless the unit is lifted and tilted to transfer it to some container.　In any case, the bottom will get a little wet, so it is a good idea to put an old towel or something underneath. In the video introducing similar products, the method of pulling one side at a time was introduced, but when I tried it, pulling both sides at the same time works well. Once you pull it upward, it keeps turning for a while, so it does not require much strength. (I don’t know how durable the rope is until I use it for a while, but I hope I can replace it with a similar rope by myself, though.). Momof2. BC. Sat Mar 15 2025

Clothes Drying Rack, Drying Rack Clothing with Height-Adjustable, Foldable Gullwings Laundry Drying Rack, Indoor Outdoor Use, No Assembly

This is exactly what I wanted and needed (who knew!). After searching high and low and being disappointed at every turn. This stand is perfect! It is sturdy, stable and can handle a full load of towels, and sheets and does not wobble. It folds to be stored away when not needed. I like that for smaller loads I can use one wing and not both. or just smaller tent. It is wonderfully flexible.. Kirti. Arlington, MA. Wed May 20 2026

Are you bothered by the fact that your clothes are always not dry or smelly in the wet weather? Then you need this clothes dryer. This avant-garde appliance not only alleviates the perils of clammy attire but also ushers in a new era of convenience and control. It is an embodiment of sophisticated technology coupled with practicality, designed to emancipate your wardrobe from the shackles of humidity.

No es muy buena. Anonymous. Thu Mar 26 2026

A handy essential for any kitchen, this set of two All-Clad silicone oven mitts dependably keeps the heat off you. Masterfully constructed with 100% heavyweight cotton twill, these durable oven mitts are silicone-treated on both sides to ensure both rights - and left-handed users enjoy heat protection up to 500℉ (260℃). Our silicone oven mitts offer plenty of flexibility, conforming to the shape of hot cookware, which means you can confidently handle hot dishes.

These gloves are great. Love the length of them.. Samantha. VA. Tue Jun 30 2026

Designed for restoration, renovation, and air quality control projects, this professional-grade HEPA air scrubber helps capture airborne particles, dust, mold spores, and other contaminants in demanding environments. The 3-stage filtration system works with an integrated UV-C light to support cleaner air circulation, while the negative air capability helps create controlled work zones and reduce cross-contamination. With variable speed control, durable construction, and low-noise operation, it is ideal for water damage restoration, mold remediation, construction cleanup, basements, garages, and job sites.

I ordered this for my husband's job. We've used it one time so far and it seems to be working well. It does use a lot of electricity since we had it plugged in we received an alert from our electric company. It is quite big. The picture make it looks smaller. I'd suggest adding a picture that would help show its size. Thank you. Anonymous. Tue Dec 09 2025

Dyson HushJet compact purifier is Dyson's most powerful, small-format purifier. Basing their design on that of jet engines, Dyson engineers developed HushJet air projection, which minimizes noise while purifying rooms of up to 203 sq ft. So, it’s compact in size yet powerfully circulates air throughout the entire room.

I am happy with my purchased. Its not noisy and the airflow is superb. Nikm. Frimley, Uk. Wed Jul 01 2026

TheCollapsiblePortableIndoorTripodClothesDryingRackistheperfectenvironmentallyfriendlyalternativefordryinglaundry.Thisthoughtfullydesignedindoorfoldingtripodhangingrackisdesignedtomakeairdryingyourclothesabreeze.Craftedwithasturdysteelframeandarms,thisrackprovidesamplestrengthandstabilitytoholdeventheheaviestofitemslikewettowelsandjeans.Itshangerslotscanaccommodatehangerplacementthroughandatoptheprovidedholes,ensuringyourclothesaredrywrinkle-free,andwithoutanymarks.Measuring64.5inchesHx26inchesindiameter,thisdryingrackprovidesamplespacefordryingafullloadoflaundry.Whennotinuse,itfoldsanddisassembleseasilytostoreinaclosetorsmallspace.Itssilverandbluecolorschemeaddsatouchofmodernstyletoyourspace,whileitscleverdesignmakesiteasytouseandmaintain.

This is the second one I bought. They are great for their purpose, drying the laundry that can’t go in the dryer. The first one I had collapsed under the weight of too many pairs of jeans and had to be replaced after a few years of use. The second one is a bit tricky to open close but I still highly recommend it.. Carol. Post Falls, ID. Mon Jun 15 2026

The compact design of this washing machine makes it perfect for those living in apartments, dorms, or RVs, where space is limited. And with the added gift of the drying rack, you can save even more money by air-drying your clothes instead of using a costly dryer.

Easy set up and space saving. I love it. Diana. CA. Sun Mar 08 2026

The Ninja Blast Portable Blender brings high-speed Ninja blending power on the go with a cordless, hand-held design. The 18-oz. vessel is perfect for smoothies, protein shakes, and frozen drinks. Blast through frozen ingredients with Ninja’s BlastBlade Assembly. Ninja Blast is rechargeable via USB-C. One-handed, easy-open sip lid and carrying handle make drinking on the go easier than ever.

Love it!. Lani. Tucson, AZ. Thu May 21 2026

This compact handheld vacuum can quickly handle even big messes all around your home, thanks to a high-capacity dirt bowl and wide mouth to scoop up debris. Lithium-powered suction stays strong until the job is done.

Easy to use and efficient. The attachments make it easy to vacuum tougher spots. Stephanie Estrella. US. Thu Jun 11 2026

Ironing boards are often fiddly to set up and difficult to store away. Pocket Plus, however, breaks the mold. We designed our revolutionary table-top and folding ironing board in blue with exceptional storage capabilities and uncompromising functionality. When not in use, Pocket Plus folds in half for easy storing and even has an integrated storage compartment for the iron. It also has the added benefit of an advanced DripLock™ cover to prevent excess water from dripping.

Great board. Looks great hang. Easy to unfold and much more stable sturdy the regular table iron board.. Marie-pierre. Newburyport, MA. Sun Jan 18 2026

✅ Cotton Hair Towels for Women - TWO PACKED Hair Drying Towel Head Towel Cap ✅ Premium Cotton Hair Towels for Women, the perfect solution for quick, effective, and gentle hair drying. Our Hair Drying Towel Head Towel Cap is designed to cater to all your hair care needs, whether you have long, curly, or anti-frizz hair. Hair Turban Towel Wrap is an essential addition to your bathroom routine, ensuring your hair dries fast and stays healthy. ✅ Quick Dry and Absorbent: Made from high-quality Turkish cotton, our towel offers superior absorbency, ensuring your hair dries quickly after a shower. ✅ Soft and Gentle: The soft material is perfect for all hair types, especially delicate, curly, and anti-frizz hair, providing a gentle touch that reduces breakage and split ends. ✅ Button Tie for Secure Fit this towel stays securely in place, making it ideal for girls, kids, and women. ✅ Perfect for use in the bathroom, bathtub, after shower, during make-up, sleep, or simply to relax. ✅ Ideal for Long Hair: Designed specifically for long hair, our towel wraps easily around your head and stays in place. ✅ Great for All Ages: Suitable for women, girls, and kids, making it a must-have accessory for the whole family. ✅ Fast Drying: Cut down your drying time significantly with our quick-dry technology. ✅ Anti-Frizz Protection: Keep your hair smooth and manageable by reducing frizz and static. ✅ Comfortable Fit: The button tie ensures a secure and comfortable fit, allowing you to move freely without the towel slipping. ✅ High-Quality Material: Crafted from soft, absorbent Turkish cotton, this towel is durable and long-lasting. ✅ Multi-Purpose: Use it for drying your hair, as a head wrap during make-up, or to keep your hair in place while you sleep or relax. ✅ After Shower: Simply wrap the towel around your wet hair, twist it, and secure it with the button tie. ✅ For Make-Up or Relaxing: Use it as a head wrap to keep your hair away from your face. ✅ For Sleeping: Keep your hair protected and in place overnight."

I love to use this after I wash my hair. Anita. Los Aacutengeles. Fri Jul 03 2026

Experience exceptional ironing with the BLACK+DECKER Elite Pro-Series Steam Iron, designed for best-in-class performance. The innovative soleplate conditions fabrics to defend against wrinkles and reduce static, while the powerful Dynamic Steam System ensures quick, efficient results. With two steam delivery modes—continuous dynamic steam and powerful steam bursts in both horizontal and vertical orientations—this iron tackles any wrinkle with ease. The unique micro-textured soft touch handle provides a comfortable grip, and the 6 preset temperature settings offer precise control for all ironable fabrics, making it the perfect tool for a smooth, fast, and wrinkle-free ironing experience.

Omg this iron is great as a quilter I’m thrilled. I do not steam when quilting this iron is the ticket. The long cord is a bonus.. Deborah. Chino, CA. Wed Jun 10 2026

✅ Introducing our luxurious 100% Cotton Washcloth Set, your ultimate bathroom essential!. Crafted from Premium Natural and Pure Cotton, these washcloths offer superior softness and absorbency, making them perfect for washing your face, body, or hands. ✅ With a generous pack of 4 washcloths, you'll have plenty for all your cleaning needs, whether in the bathroom, kitchen, or elsewhere in your home. Their thick and fluffy texture ensures efficient cleaning, while remaining gentle on surfaces. ✅ These washcloths, also known as washrags, aren't just for personal use; they're also ideal for gift-giving, whether for a baby shower, housewarming, or any special occasion. ✅ Upgrade your cleaning routine with our Luxury Cotton Washcloth Set, and experience the luxury of soft, absorbent washcloths in every use.

Pleasantly surprised at the quality color. Soft absorbent.. Deb. Mon Jun 08 2026

Our microfiber towels hair is premium ,super soft and absorbent. One of the most cost-efficient microfiber bath towel you could ever get. Give our microfiber hair towels as gift of comfort to your loved ones. Believe they will be very happy to receive it.

Finally a great hair towel that is thick and absorbent and easy to use. No more big bath towel wrapped around my head! Love the colors.. Joanne. Colchester, VT. Wed Mar 04 2026

Your Key to a Clean Home With 25kPa powerful suction and versatile cleaning tools, the 1400W Aspiron canister vacuum cleaner effortlessly captures 99.9% dust and dirt on multiple surfaces. Its 5-stage filtration system ensures clean air output, making it perfect for those with allergies. The lightweight design, convenient handle, and wheels make it easy to move or carry for whole home cleaning. Remove dust, dirt, pet hair, and more, and enjoy a pristine living space with this powerful and reliable cleaning solution!

This stick vacuum has amazing suction! Additionally, there are numerous various-sized attachments and an extra filter. I vacuumed throughout the house and changed plugs once because of the long extension cord.  The head swivels in every direction, and it works wonderfully on the edge of the stairs. Judy. Plymouth, WI. Fri Nov 10 2023

Large Capacity: Designed with a 50.7oz large capacity water tank, this steam cleaner for car with a 16ft long power cord provides up to 50 minutes steaming time, which is ideal for whole-home cleaning without interruption

This is such a great little steamer. I was surprised to see all the accessories. I did not realize you can do clothes, carpet, windows, and floors. I used it on our hardwood floors and it did an amazing job. Very easy to use and not bulky. Perfect for so many uses!. Carla. Oxford, MS. Wed Jul 08 2026

Hello, meet the projecting iron. Designed just for sewing, quilting plus crafting. With the power of a full-sized iron in a compact and lightweight design, the list project iron fits right next to your sewing machine or in your travel bag. The project iron comes with a so you can leave your list project iron in the face-down position. The soulmate also protects and allows you to also project iron easily and safely. The project iron fits snugly into the palm of your hand and has been weight-balanced for precision movement and minimal strain on your wrist. It features a diamond-coated ceramic sole plate, flat pressing surface, detailer tip, and an 8-foot cord for a full range of motion.

I love this handy little iron. It’s great for sewing projects. Victoria. US. Wed Jun 03 2026

Combatting wrinkles is easy with the #1 US brand in irons *. The BLACK+DECKER Cord Reel Iron features a 2x more durable** stainless steel sole plate for long-lasting durability and a 36% lighter design*** for easy handling. The iron features a burst of steam & ergonomic spray mist button for powerful wrinkle removal and quick misting. Use it to vertically steam garments or draperies for professional results at home. The automatic cord reel allows for quick storage and a tidy ironing area, while the auto clean system keeps your iron running smoothly. The anti-drip system prevents water spotting at lower temperatures, with an easy fill 250ml water tank. *Source: Circana, Retail Tracking Service, US unit sales, 12 months ending May 2024. **compared to standard ceramic. *** lightweight design vs. D3301

Light weight and like that the cord reels back into iron and the tip gets into the hard and bulgy places. Maxine. Shadyside, OH. Sun Jun 21 2026

Shield your hands from the heat with the KitchenAid Asteroid 2-Pack Mini Mitts. Now moving dishes and bakeware in the oven is made safer and easier. These mini mitts each measure 5.5 inches wide by 8 inches long for easy on-and-off use while handling hot pots, pans, and dishes. The heavy-duty, 100 percent cotton fabric on the outside as well as the cotton lining offers comfort, flexibility, and insulation. Textured, silicone print grips on the mitts are heat resistant and also ensure a firm and more secure grip when handling dishes and cookware. The matching oven mitts feature a convenient hanging loop to easily display or store them when not in use. These mini mitts are easy to clean and machine washable for easy care. Use your KitchenAid Asteroid Mini Mitts 2 Pack along with coordinating kitchen accessories from KitchenAid including potholders and kitchen towels for a complete set of KitchenAid kitchen essentials. Each item is sold separately. Perfect for cooking and baking. Give the KitchenAid Asteroid Mini Mitts as a gift to a friend or family housewarming, on holidays, or on any special occasion. Made in China.

Everything you think they will be a need to be!. Sophia. OH. Tue May 12 2026

Hair towels are made of a super absorbent microfiber towel, breathable, odorless for quick dry hair

These are the perfect, light weight and absorbent, hair towels. I will definitely get more!. Julie. Omer, MI. Fri May 22 2026

These lovely items are perfect for use around stove tops and when reaching in and out of hot ovens and the microwave. This pot holder doubles as a trivet or hot pad.

Well Wayfair you did it again sooo I love with this kitchen mat great for all your kitchen hot points.. Rosalyn. Center Point, AL. Mon Mar 16 2026

This pillowcase is made with high-quality 100% microfiber fabric for optimal softness and easy care. They're silky and soft against your skin, reducing facial creases and wrinkles. Wrinkle-free, stain and fade-resistant, easy to care for. The hidden zipper closure prevents slipping and ensures that the pillow stays perfectly in the satin pillowcase. The unique zippered closure is placed on one side, the satin pillowcase can be used on both sides.

So far the pillowcases are working fine. These are the only pillowcases that I use as all my pillows are in satin pillowcases. As far as washing, I’m not sure about this brand. But, I have other brands that seem to still be hanging in there after more than five years.. Jerrice. Farmington Hills, MI. Sun Jun 07 2026

Cordless Handheld Vacuum Cleaner:This handheld vacuum boasts a maximum suction power of 12,000Pa and a high-speed motor running at 40,000 RPM. It offers dual-mode functionality with (6.5KPa) and (12KPa) settings, making it ideal for both daily cleaning and deep cleaning tasks. Whether it's tackling dirt in floor crevices, deep carpet fibers, sofa seams, or car seats, this vacuum efficiently removes pet hair, food crumbs, small stones, and other debris with ease.

Quiet with easy to clean filter.. Anonymous. La Mesa, CA. Sat May 16 2026

Experience the ultimate in laundry efficiency with this high-capacity, 2-in-1 dual tub washing machine! Designed to save you precious time, this "lavadora" features two independent tubs that allow you to wash and spin-dry your clothes simultaneously. With a powerful **360-watt wash motor** and a **180-watt spin motor**, this upgraded model handles large loads with ease—boasting a **19-pound wash capacity** and an **11-pound spin capacity**. Whether you’re managing a week’s worth of laundry or a quick load of delicates, this machine ensures a professional clean without the wait.

Great suitcase for your Luggage racks!

Time to use this professional washing machine to save hassle for your hands, free your hands. Our twin tub washing machine is perfect solution for doing laundry in limited space. Powerful motor makes your washing more faster and cleaner, meanwhile more convenient and less energy consumption.

This portable washing machine performs exceptionally well. The spinner effectively dries clothes almost completely. The machine produces exceptionally clean results, is quick and easy to use. Thank you.. Natasha Radenovic. CA. Thu May 14 2026

Experience the rapid action of Woolite INSTAclean Stain Remover, lifting stubborn stains and odors from carpets, upholstery, rugs and car interiors instantly.

Would greats, removed stubborn stains. Donald W. Gilmer, TX. Fri Dec 12 2025

Pet Hair Remover for Laundry, Reusable Lint Catcher Trap for Washing Machine, Removes Dog & Cat Hair

I'm allergic to ALL dryer sheets but I own a dog and sometimes it's nice to not have hairy clothes come out of the dryer. These little balls do the trick more so than the plastic dryer balls I put in.. Anonymous. Tue May 26 2026