This sturdy holder is a more convenient way to store your messy detergent cup and catch the drips! Well designed to fit any economy-sized laundry detergent and fabric softener without sticky residue on surfaces and long cleanups after each load. Our simple attachment will help keep your laundry room as clean as your laundry. No drips, no mess, no fuss.

I love this it is very easy on me because I can just pour it now. Shelia. Charlotte, NC. Wed Aug 05 2026

YBM Home square plastic Wash Cup (Netilat Yadayim) and Wash Basin (Nigel Vasser) Set. Large, kosher, and long-lasting for ritual hand washing. YBM Home hand Washing Cup and Wash Basin Set are used for ritual hand washing. Traditional Judaism requires ritual washing of the hands for a number of reasons including after a full night's sleep, before eating bread with a meal, after going to the bathroom, during the Passover seder, or at other times to remove impurity.

exactly what I was looking for.. bin was slightly smaller then i expected cup size was great. Sara. Pittsburgh, PA. Sun Jan 17 2016

Are you tired of cleaning up the laundry soap from the front of the dryer, washing machine, or the floor and anything that soap gets all over? No one likes a mess in the laundry room: This simple, easy, and convenient design of the Besuerte laundry soap cup holder will be fixed all of your issues with the detergent jug. The tray catcher laundry detergent cup holder Not only holds the bottle spout firmly but also gets every last drop of detergent out of the laundry bottle without a struggle. Also reduces waste and keeps you from having to stand the laundry bottle upright every time when it is done using. Drip Trip Catcher/Cup Holder Dispenser ideas This sturdy holder is a more convenient way to store your messy detergent cup and catch the drips! Well designed to fit any economy-sized laundry detergent and fabric softener without sticky residue on surfaces and long cleanups after each load. Our simple attachment will help keep your laundry room as clean as your laundry.

I am so happy with this purchase! I only have use of one arm and had to stop using pourable laundry detergent. (Unable to hold and pour) Thanks to this organizer, I can go back to my pourable laundry detergent. Much cheaper than pods.. C. Mon Mar 23 2026

Are you tired of cleaning up the laundry soap from the front of the dryer, washing machine, or the floor and anything that soap gets all over? No one likes a mess in the laundry room: This simple, easy, and convenient design of the Besuerte laundry soap cup holder will be fixed all of your issues with the detergent jug. The tray catcher laundry detergent cup holder Not only holds the bottle spout firmly but also gets every last drop of detergent out of the laundry bottle without a struggle. Also reduces waste and keeps you from having to stand the laundry bottle upright every time when it is done using. Drip Trip Catcher/Cup Holder Dispenser ideas This sturdy holder is a more convenient way to store your messy detergent cup and catch the drips! Well designed to fit any economy-sized laundry detergent and fabric softener without sticky residue on surfaces and long cleanups after each load. Our simple attachment will help keep your laundry room as clean as your laundry.

Absolutely love these. I take apart and clean when there are drips and put it right back on!. Stefanie. Marietta, GA. Mon Jul 13 2026

This practical, all-in-one storage solution keeps everything you need to make ironing easy in one place. It comprises a large, wall-mounted caddy with separate compartments for storing iron and its cable, alongside a handy 350ml steam-iron jug for water top-ups. A heat-resistant, silicone iron pad inside protects your iron and prevents scratching. In addition, the caddy features a sturdy, universal hanging hook that can be adjusted to hold a wide variety of ironing boards with T-shape and Y-shape stands. The whole unit mounts securely to the wall with the screws and wall plugs provided and comes with full installation instructions.

The “hooks” that are supposed to hold the ironing board are definitely not in a great place. I took the set apart and hung them separately. It works fine now.. Anonymous. Sat Sep 12 2026

Sunny day essential, Clothes smell like sunshine. Air-dry your laundry naturally – energy-saving and wrinkle-free. Every day, enjoy the fresh, sun-kissed goodness.

Exactly as described. Very happy with this purchase.. Kathy. Thu Jul 02 2026

Tired of dusty lint and dryer sheets making your laundry area appear cluttered? These space-saving magnetic lint bins will keep lint, used dryer sheets, and other laundry room debris in their place and out of sight. With sturdy construction and a slim profile, our bins easily slip into that tight space between the dryer and the wall. Here are some additional uses for your new bins! Attach them to your washer and use them as a receptacle for mismatched socks or dryer sheets. Load them up with office and school supplies for your student or for your home office. These bins are also the perfect spot to collect plastic grocery bags. Plus, you can use a small trash bag in the bin for easy disposal of lint and dryer sheets. Simply pull it out, tie it up, and it's ready for the trash while keeping your lint bin looking clean. Our lint bin organizers come in a universal design that works well with any laundry room, kitchen, workroom, or office decor. There’s no need to worry about the bins sliding down your washer, dryer, or refrigerator - the large, powerful magnet on the back will hold each bin and its contents securely in place.

Love this! It’s a real helper for laundry/dryer sheets. Keep everything handy!. Susan. Fri Nov 17 2023

Add the Over‑the‑Door Ironing Board with Self‑Closing Slim Frame and Cotton Cover to home routines for a smart, space‑saving solution. Designed to hang securely on standard or commercial doors, this ironing board features a steel frame and perforated mesh board that allows steam and heat to circulate for even ironing results. The board measures 14 inches wide and 41 inches long, with a padded cotton cover and bungee cord binding for durability. A U‑hook iron holder at the top provides convenient storage, while two stabilizing feet protect the door and keep the board steady during use. Lever‑action opening and closing makes setup effortless, and when folded, the board measures just 2 inches deep, conserving valuable space. Perfect for apartments, dorms, condos, or RVs, this ironing board combines practicality, durability, and compact design to make ironing simple and efficient.

The iron holder & iron board holder is well constructed and fits good where it is placed. No complaints. Juanita. Rock Hill, SC. Wed Apr 15 2026

Get a load off your shoulders with this lift-o-matic rotary clothesline. Giving you 164 ft of drying space, you can also adjust the rotary seamlessly to your ideal working height (from 50.8 in. To 73.6 in). Easy to turn, always taut lines and it will take your clothes hangers too! A great dryer for launderers big or small. This rotary lift-o-matic clothesline also includes a ground spike, protective cover, clothes pin bag, and wooden clothes pins - everything you need for drying your clothes naturally.

This is Old School and Exactly as described, Easy to Install, Handsome Cover When not in Use. Wood. Edenton. Tue Sep 29 2026

Free up space and banish laundry room clutter with this stylish wood organizer. Enjoy the ease of a freestanding design, perfect for creating a tidy and efficient laundry area.

Everything it says it is. Like the "retro" look of it.. Elizabeth. ME. Sun Aug 30 2026

Use this handy magnet to identify all the important laundry symbols used on clothing and textile care labels. Constructed of stainless steel, it has a strong magnetic backing for convenient placement on a washing machine or dryer. When all the right people and ingredients, kitchen tools, and food come together.

I’ve been looking for something like this for a while. The magnet is strong and it’s small enough to fit on front load washer or dryer. I never had a clue what the symbols on the clothing tag meant so this so helpful.. Natalie. Hoover, AL. Thu Apr 09 2020

Keep your Brabantia rotary dryer in place with this smart metal ground spike – for anyone that wants sturdy anchorage without concrete. The spike has a closable cap and is made of galvanized steel plate, so completely corrosion resistant too.

these were way to big for my needs so i sent them back...but if anyone needs something like this to keep something in place, they are heavy duty, well priced, packed exceptionally well, and would certainly keep your pole in place for years to come..... Deborah. Webster, NY. Sun Mar 23 2025

The Brabantia folding board fits in any closet and is the perfect aid to quickly folding shirts and sweaters. How? The board has step-by-step instructions on the front and the back. And when your wardrobe is neatly organised, hang the board in your cupboard on its extra large hook. Handy!

So cute and handy!! I love how small and functional this is! Thankfully it even has diagrams for both long-sleeved shirts and short sleeves so there is little to no chance of messing up my organization skills now! And I love that it can be hung up too and easily put away so it takes up no space at all. Deanna. Corpus Christi, TX. Sun Aug 03 2025

ThePortableIndoorTripodClothesDryingRackistheperfectenvironmentallyfriendlyalternativefordryinglaundry.Thisthoughtfullydesignedindoorfoldingtripodhangingrackisdesignedtomakeairdryingyourclothesabreeze.Craftedwithasturdysteelframeandarms,thisrackprovidesamplestrengthandstabilitytoholdeventheheaviestofitemslikewettowelsandjeans.Itshangerslotscanaccommodatehangerplacementthroughandatoptheprovidedholes,ensuringyourclothesaredrywrinkle-free,andwithoutanymarks.Measuring64.5inchesHx26inchesindiameter,thisdryingrackprovidesamplespacefordryingafullloadoflaundry.Whennotinuse,itfoldsanddisassembleseasilytostoreinaclosetorsmallspace.Itssilverandbluecolorschemeaddsatouchofmodernstyletoyourspace,whileitscleverdesignmakesiteasytouseandmaintain.

Great purchase.. Kara. Merritt Island, FL. Sun Jun 14 2026

Laundry Line - gallery wrapped canvas. A hand stretched canvas with a solid wood stretcher. Each piece is made to order. Built to last. Each piece comes ready to hang. Solid wood stretcher. Fade and water resistant. Made domestically.

Very light weight. Cute but has some defects on it.. Kelli. Shelburne, ON. Mon Apr 27 2026

Add the 2‑Tier Tripod Clothes Drying Rack to every home for a versatile blend of practicality and convenience. Designed with six arms and two independent tiers, this rack holds up to 72 hangers plus four clothespin clips for smaller items, making it ideal for drying laundry or hanging freshly ironed clothes. Perfect for Indoor or outdoor use, it fits seamlessly into laundry rooms, bedrooms, patios, or RVs. The adjustable height ranges from 70 to 77.5 inches, while reinforced tripod legs provide stability. Its collapsible design folds down to a compact 7" x 5" x 42" size, making it easy to store or travel with. Use it by the pool for wet swimsuits and towels, or take it camping for portable garment storage. With a weight limit of 6.6 lbs. per arm (39.6 lbs. total), it ensures reliable performance when evenly loaded. No tools are required for assembly, making setup quick and hassle‑free. Bring smart organization, wrinkle‑free drying, and portable convenience into home today.

Ben using it ever since I got it 2 years ago. It’s great. Aside from the plastic clips that break off. But it’s great other than that.. Anonymous. Tue Jul 21 2026

Introducing a versatile clothes drying rack designed to maximize efficiency and convenience in your laundry routine. Perfect for small spaces, this rack stands at 23.6"D x 23.6"W x 75.2"H when in use, and can be easily folded down to a compact 1.9"D x 1.9"W x 87.4"H for storage, ensuring it stays out of the way when not needed. Its 360° rotatable arms allow you to effortlessly hang or remove clothes from any angle, making air drying a breeze. With the capacity to hold up to 54 garments, thanks to strategically placed holes for hangers, it can support a static load of up to 33 pounds, accommodating a variety of clothing and accessories. The rack is constructed from durable stainless steel, providing rust resistance and stability, with four legs offering enhanced support compared to traditional three-legged designs. Assembly is straightforward, consisting of only seven parts that can be set up or taken down in a minute, making it perfect for both home use and outdoor adventures like camping. This drying rack is the ideal solution for those seeking a reliable, space-saving option for drying clothes efficiently.Note:- Use the product only on flat ground. Make sure the load is evenly distributed when hanging clothes on the 6 supporting arms. Heavier clothing should be hung near the main pole.Parameters:- Product Dimensions: 23.6"D x 23.6"W x 75.2"H (60 x 60 x 191 cm)- Folded Size: 1.9"D x 1.9"W x 87.4"H (4.8 x 4.8 x 222 cm)- Product Weight: 2.9 lb (1.3 kg)- Max. Static Load Capacity per Top Arm: 4.4 lb (2 kg)- Max. Static Load Capacity per Lower Arm: 6.6 lb (3 kg)- Max. Static Load Capacity Total: 33 lb (15 kg)- Material: Stainless Steel, Plastic- Color: BlackPackage List:- 1 x Clothes Drying Rack

Great. Doesn't take up too much space.. Martha. US. Sun May 03 2026

This laundry basket features a unique hollow design that allows for free airflow, keeping your clothes dry and free from musty odors even during humid seasons, ensuring the health of your family. Made from high-quality materials, it is pressure-resistant and deformation-resistant, ensuring durability over time. It unfolds quickly with a single button press and folds away effortlessly, adapting perfectly to both spacious areas and tight corners, maximizing every inch of your home.

Cute and love the wheels. Was a little difficult to put together.. Suzanna. US. Wed Oct 07 2026

Make laundry easier with this foldable clothes drying rack featuring 6 adjustable height settings for shirts, coats, quilts, and more. The indoor and outdoor drying rack folds down to a compact 40.4" × 22.8" size for easy storage. With a sturdy triangle base and non-slip feet, this laundry drying rack provides reliable support and space-saving convenience.

Just received product. Looks like it will serve the purpose it was purchased for. Easily assembled. Shipping was a bit delayed but only by a couple of days.. Gerald. North Augusta, SC. Wed Oct 07 2026

Are you tired of cleaning up the laundry soap(laundry organization and storage) from the front of the dryer, washing machine, or the floor and anything that soap gets all over. No one likes a mess in the laundry room(laundry room organization and storage): this simple, easy, and convenient design of the Besuerte liquid detergent dispenser will be fixed all of your issues with the laundry storage containers jug.  The laundry soap dispenser for liquid detergent Not only holds the bottle spout firmly but also gets every last drop of detergent out of the laundry bottle without a struggle. Also reduces waste and keeps you from having to stand the laundry detergent drip tray bottle upright every time when it is done using. 

Looks beautiful! Would definitely recommend. Wendy. Sat Jul 25 2026

This magnetic folding shelf is made of premium material and is durable. It features a hollow design, combining beauty with practicality. The back is ingeniously equipped with magnets, allowing for easy installation. It helps you make flexible use of space and is an ideal storage organizer for modern minimalist homes and office environments.

This is a great shelf! Very strong magnetic holding power. It’s going to make my life easier getting to laundry supplies now. Won’t have to reach up to the high shelf. Just unfold it and it was ready to use. Would recommend.. Debra. Pensacola, FL. Tue Aug 18 2026

Add the Rolling Laundry Cart with Basket, Hanging Bar, Shelf, and Locking Wheels to laundry routines for a practical and stylish solution. Featuring a tall oversized basket, this cart easily accommodates multiple loads of laundry. A lower shelf provides space for folded clothes or laundry products, while the top hanging bar is ideal for drying or organizing freshly laundered garments. Constructed with durable metal tubing and finished with a sustainable chrome‑like powder coat, the cart combines strength with modern appeal. Four swivel wheels allow smooth mobility, with two locking wheels for added stability when stationary. Measuring 67.5 inches high, 24.63 inches wide, and 20.69 inches long, it is suitable for both home and commercial use. Easy to assemble and built to last, this rolling laundry cart brings convenience, organization, and efficiency to everyday laundry care.

Sturdy cart with solid easy to roll wheels!. Crystal. Manor, TX. Tue Jul 11 2023

This rolling laundry basket with ergonomic handle design reduces back strain when pushing or pulling, allowing you to transport heavy loads without bending over – a thoughtful back‑saving laundry solution for any home. Crafted from sturdy iron with a rust‑resistant finish, this heavy‑duty laundry cart supports up to 150 lbs, easily handling large bedding, towels, and piles of clothes. Equipped with 4 smooth 360‑degree rolling wheels (2 lockable), this mobile laundry sorter moves seamlessly between bedrooms, bathrooms, and laundry rooms – even across different floors. The large capacity ventilated basket keeps dirty clothes neatly stored while preventing odor buildup, making it ideal for families or individuals with heavy laundry needs. Quick and easy assembly gets you organized in minutes, while the sleek design complements any bedroom, bathroom, or laundry room decor – a practical, stylish, and durable laundry storage cart that simplifies your daily routine.

Tote everything from produce and picnic goodies to camping gear and cleaning supplies in this Multipurpose Collapsible Basket by Trademark Home Collection. Featuring a popup design for quick deployment when you need a garden basket, this foldable basket boasts a comfort-grip handle and lightweight design for seamless use as a collapsible container for washing dishes on camping trips, berry-picking basket on hikes, and portable bucket for icing down drinks at tailgate parties. This plastic basket with handles folds down to just 2-inches-high when you need to take it along on roadtrips or store it in compact spaces.

Love this, They do wear out after a few years but what a great idea to save space!. Nicole. Lillington, NC. Tue Sep 29 2026

Tired of dusty lint and dryer sheets making your laundry area appear cluttered? These space-saving magnetic lint bins will keep lint, used dryer sheets, and other laundry room debris in their place and out of sight. With sturdy construction and a slim profile, our bins easily slip into that tight space between the dryer and the wall. Here are some additional uses for your new bins! Attach them to your washer and use them as a receptacle for mismatched socks or dryer sheets. Load them up with office and school supplies for your student or your home office. These bins are also the perfect spot to collect plastic grocery bags. Plus, you can use a small trash bag in the bin for easy disposal of lint and dryer sheets. Simply pull it out, tie it up, and it's ready for the trash while keeping your lint bin looking clean! Our lint bin organizers come in a universal design that works well with any laundry room, kitchen, workroom, or office decor. There’s no need to worry about the bins sliding down your washer, dryer, or refrigerator—the large, powerful magnet on the back will hold each bin and its contents securely in place.

This is a great little lint container, and I love that it's magnetic. It is smaller than I expected, but it will do the job.. Elizabeth. Red Bank, NJ. Sat Oct 15 2022

Add the Expandable Clothes Drying Rack with Telescopic Rods and Drying Net to any laundry routine for a stylish and energy‑saving solution. A collapsible rack in sleek silver offers both durability and sophistication, making air drying clothes effortless while preserving their shape and structure. Perfect for Modern or Contemporary interiors, this versatile rack expands from 20 inches to 34.5 inches wide, giving ample space for larger loads or heavier garments. Use it to air‑dry clothing, towels, bathing suits, or delicate items, while the included drying net provides a flat surface for smaller pieces. Made of durable metal with telescopic rods, it folds compactly when not in use yet looks striking enough to display openly. Measuring 24.5 inches in length, 34.5 inches in width, and 34.5 inches in height, this rack combines practicality with timeless style. Bring energy savings, convenience, and a touch of silver elegance into any home today.

Perfect for drying clothes without the neighbors noticing. Adele. Fairfield, CA. Fri Jul 24 2026

This sturdy floor‑standing unit fits over washers and dryers without interfering with operation, working with both top‑load and front‑load sets. It features 4 adjustable shelves (160–220mm clearance, 20mm spacing) and dual‑layer storage to organize detergent, towels, and accessories. Designed with an anti‑tip kit, leveling feet, and a corrosion‑resistant coated metal surface, it provides stable, long‑lasting storage for any laundry room layout.

The shelving unit came well packaged and the instructions to put it together were very clear, it took me less than an hour to do it by myself. The shelving material is very nice which makes the unit very sturdy. I would take note that after assembly it needs to be placed behind the washer and dryer set so hoses and wires should be unpluggeddisconnected from the wall. I’m in a rental property and have a very tight laundry closet so I had to pull out the washerdryer to install this shelving unit. Once installed though it has been so nice to have the extra shelving to place my laundry essentials and storage bins within reach. It makes the space look well organized and aesthetic! Highly recommend!. V.. San Antonio, TX. Tue Aug 11 2026

Add the Parallel Clothesline Outdoor Dryer with Steel Frame to outdoor laundry routines for a reliable and efficient drying solution. Featuring a pivoting steel top, this dryer ensures every inch of line is evenly within reach, making hanging laundry simple and convenient. Crafted with a galvanized steel post, steel top, and durable plastic clotheslines, it offers long‑lasting strength and stability. The included ground sleeve secures the post firmly, with recommended cement installation for maximum support. When not in use, the steel top folds down and the pole can be removed from the ground anchor, protecting the dryer from inclement weather. Measuring 72 inches high, 72 inches wide, and 84 inches long, it provides a impressive 210 feet of drying space across 30 lines—perfect for large laundry loads. With its sturdy build and thoughtful design, this parallel dryer brings practicality, freshness, and timeless utility to everyday laundry care.

Just what I was looking for. Helps save money on electric bills (electric dryer).. David. San Jose, CA. Sun Feb 23 2025