13 Cu Ft Portable Twin Tub Washing Machine Top Load Washer13 2lbs Spinner 8 8lbs Blue

Our portable washing machine with twin tub design, wash and spin simultaneously. Comes with 1 drying rack & 10 hangers. Three knobs make it easy to operate, even for seniors. Each cycle is super fast, saving you time. Compact size fits any space, no installation needed. Energy and water efficient, with durable plastic body preventing rust.

It’s smaller than I imagine but it does the job well.. Anonymous. Wed Jun 24 2026

Still, worried about washing clothes? Get a washing machine and free your hands! Designed with one of two tubs for washing with a 19 lb. capacity and the other for spin drying with an 11 lb. capacity. The portable washing machine brings a lot of convenience to your life. This compact washer and dryer combo runs on 110v power and has a spin speed of 2000 RPM. features a pump drain! Even though your washer is on a higher level, you don't need to worry about drainage at all. This double-drum washing machine has individual time controls and is very easy to operate. You can also choose how much water you want to fill it with. This mini washing machine is not only eco-friendly but also energy and water-efficient, saving your family money by saving up to 84% on energy consumption compared to similar models. The compact and lightweight design makes it easy to install in your bathroom or closet. Our 2-in-1 portable washing machine features labor-saving operation and labor-saving design. Don't hesitate to add it to your cart!

Nice it is but I have buy adapter for kitchen sink and wish it was on wheels but it's very nice. Looks good in apartment nice size highly recommend it. Betty. Louisville, KY. Fri Jul 10 2026

Experience the ultimate in laundry efficiency with this high-capacity, 2-in-1 dual tub washing machine! Designed to save you precious time, this "lavadora" features two independent tubs that allow you to wash and spin-dry your clothes simultaneously. With a powerful **360-watt wash motor** and a **180-watt spin motor**, this upgraded model handles large loads with ease—boasting a **19-pound wash capacity** and an **11-pound spin capacity**. Whether you’re managing a week’s worth of laundry or a quick load of delicates, this machine ensures a professional clean without the wait.

The compact design of this washing machine makes it perfect for those living in apartments, dorms, or RVs, where space is limited. And with the added gift of the drying rack, you can save even more money by air-drying your clothes instead of using a costly dryer.

Easy set up and space saving. I love it. Diana. CA. Sun Mar 08 2026

Tired of hauling laundry to the laundromat or struggling with limited space at home? This portable twin tub washing machine is the perfect solution for apartments, dorms, RVs, or anyone needing a compact and efficient way to do laundry. With a generous 19 lb washer and 11 lb spinner capacity, it easily handles daily loads while staying small enough to fit tight spaces. Simple control knobs make it easy for anyone to operate, and the powerful dual motor system delivers deep cleaning with up to 84% less energy use. Separate timers for washing and spinning give you flexibility for different fabrics and load sizes, while the lightweight, no-installation design means you can move and use it anywhere with ease. Whether you’re washing everyday clothes, baby items, or delicates, this machine brings clean laundry to your fingertips — no hookups, no hassle.

Time to use this professional washing machine to save hassle for your hands, free your hands. Our twin tub washing machine is perfect solution for doing laundry in limited space. Powerful motor makes your washing more faster and cleaner, meanwhile more convenient and less energy consumption.

This portable washing machine performs exceptionally well. The spinner effectively dries clothes almost completely. The machine produces exceptionally clean results, is quick and easy to use. Thank you.. Natasha Radenovic. CA. Thu May 14 2026

Experience the ultimate laundry efficiency with this innovative twin tub portable washing machine that revolutionizes your washing routine! Featuring separate 19 LBS washing and 11 LBS spin-drying tubs, this powerful dual-function design allows you to wash and spin simultaneously or move clothes between tubs, dramatically reducing laundry time while maximizing productivity for busy households.

It was perfect for someone just not me. Andra. Fort Worth, TX. Thu Jun 11 2026

Samsung's 5.4 cu. ft. Extra-Large Capacity Smart Top Load Washing Machine is equipped with Pet Care Solution, which removes 6X more pet hair1 with Pet Care Wash Cycle that loosens hair to be trapped by dual pet hair filters. With Super Speed Wash, powerfully clean a full load of laundry in just 28 minutes without sacrificing cleaning performance.* *Based on using Super Speed on a Normal Cycle with an 8lb load

It was so big and it works perfectly fine and i really i appreciate the delivery person. I highly recommend to anyone. Chidera S Udeani. Sat May 02 2026

Trust the Compact and Portable Washer for easy, energy-efficient operation. Simply insert detergent and water and watch it work thanks to the transparent tub container. It requires no special parts or plumbing.

Super tiny thats my fault though I didnt read all the specs so I mean itll wash like a handful of dishrags Im sure itll be great for camping trips to keep your bathing suits and towels clean. IM ADDING TO THIS REVIEW JUST A LITTLE BIT MORE TO LET YALL KNOW IVE HAD IT FOR OVER A MONTHNOW AND I USE IT ATLEAST EVERY 3 DAYS IT GETS THE JOB DONE BUT ALSO KNOW i DONT HAVE KIDS SO MY loads arent that big like a whole load of laundry is more like 5 10 loads but when u dont have anything else to do anyways its pretty awesome. Natalie Torrance. Pensacola, FL. Sat Oct 03 2020

Samsung's large-capacity smart gas dryer is equipped with the pet care dry cycle that helps remove 97% of 3 unpleasant pet odors. Steam Sanitize+, which removes 95% of pollen from fabric, while multi-steam refreshes clothing and relaxes light wrinkles. With Wi-Fi connectivity, you can remotely start, stop, or delay your dryer from our simple-to-use smart things app.

Love the options and efficiency. Stacey. Northlake, IL. Thu Jul 09 2026

Samsung's 5.4 cu. ft. extra-large capacity smart top load washing machine is equipped with a pet care solution, which removes 6x more pet hair1 with a pet care wash cycle that loosens hair to be trapped by dual pet hair filters. With super speed wash, powerfully clean a full load of laundry in just 28 minutes without sacrificing cleaning performance.

I love it so far! Modern and Sleek.!. Lori. Thu Jan 22 2026

fully automatic washing machine

I am an extensive shopper. Only a bargain for me or I wait till later. This machine had the highest ratings of any portable washer. It is very easy to operate. Turn it on and it has a default program, but you can program change to a different setting. It gets my clothes clean. I am happy with it. I got my money's worth.. Leslie. Livingston, TX. Sun Mar 08 2026

At GE Appliances, we bring good things to life, by designing and building the world's best appliances. Our goal is to help people improve their lives at home by providing quality appliances that were made for real life. Whether it's enjoying the tradition of making meals from scratch or tackling a mountain of muddy jeans and soccer jerseys, GE Appliances is crafted to support any and every task in the home.

i love the 20 minute quick wash feature. Installation was quick and easy. I have no complaints so far.. Miyako. Little Rock, AR. Thu May 14 2026

The Electrolux front load washer features LuxCare Wash and Perfect Steam technology to provide a thorough clean for clothing and fabrics. The 18-Minute Fast Wash cycle allows you to quickly deep-clean the items you need the most.

Excellent product the top of the washing machine itself, scratches and dense very easily poorly made. Ilene. US. Thu Mar 12 2026

Samsung's large-capacity smart gas dryer is equipped with the pet care dry cycle that helps remove 97% of 3 unpleasant pet odors. Steam Sanitize+, which removes 95% of pollen from fabric, while multi-steam refreshes clothing and relaxes light wrinkles. With Wi-Fi connectivity, you can remotely start, stop, or delay your dryer from our simple-to-use smart things app.

Love the options and efficiency. Stacey. Northlake, IL. Thu Jul 09 2026

Are you bothered by the fact that your clothes are always not dry or smelly in the wet weather? Then you definitely need this folding remote control dryer. It has over-temperature protection so you don't have to worry about any safety hazards of forgetting to turn it off. It works at less than 45 decibels and won't disturb your work or rest when it's running. In addition, it also has an intelligent remote control, which makes operation easier and more convenient.

The thinner poles don’t line up but otherwise works for my needs.. Joy. US. Sun Apr 27 2025

Samsung Bespoke 5.3 cu. Ft. ultra capacity front load washer has a sleek,flat-panel design, comes in new premium colors, and is equipped with smart features that simplify your laundry experience. It has our AI optiwash, which senses soil levels and automatically adjusts time and detergent* for a worry-free wash, and auto dispense, which conveniently stores and automatically dispenses up to 32 loads of detergent and softener.

Beautiful set. Delivery was great!. Pam. Wichita, KS. Sat Dec 14 2024

Refresh small loads and de-wrinkle larger loads with the power of steam

Great. Anonymous. Tue May 12 2026

Could not be happier with this dryer and it looks great.. Alicia. Reno, NV. Sat May 09 2026

Built on the belief that modern life needs modern solutions, GE Profile Appliances are designed to make daily life simpler by incorporating Smart Home technology and cutting-edge features in every appliance. GE Profile’s sleek design and quality engineering will give your kitchen the most up-to-date look and the best innovative performance you’ve been looking for.

So far excellent purchase! Holds a lot of clothing. Cleans well. Many cycles.. Lori. Sun Feb 08 2026

Built on the belief that modern life needs modern solutions, GE Profile Appliances are designed to make daily life simpler by incorporating Smart Home technology and cutting-edge features in every appliance. GE Profile’s sleek design and quality engineering will give your kitchen the most up-to-date look and the best innovative performance you’ve been looking for.

Washer is big and cleans great so far. No complaints. But the shipping took long time and had to ask where it was. 2 days late after I had to call .. Robin. China, MI. Tue May 26 2026

A great manual laundry dryer is the ideal choice for your convenient life. It adopts a manual rope-pulling operation to generate strong centrifugal force to remove most of the moisture from clothes, greatly reducing the time required for drying. The compact and lightweight design is easy to move and store. Whether it's to improve laundry efficiency or meet the needs of outdoor activities, this dehydrator can provide significant assistance, allowing you to enjoy a more relaxed laundry experience.

If the clothes are balanced in the machine, water can be taken out efficiently. However, the squeezed water will not flow well naturally unless the unit is lifted and tilted to transfer it to some container.　In any case, the bottom will get a little wet, so it is a good idea to put an old towel or something underneath. In the video introducing similar products, the method of pulling one side at a time was introduced, but when I tried it, pulling both sides at the same time works well. Once you pull it upward, it keeps turning for a while, so it does not require much strength. (I don’t know how durable the rope is until I use it for a while, but I hope I can replace it with a similar rope by myself, though.). Momof2. BC. Sat Mar 15 2025

Built on the belief that modern life needs modern solutions, GE Profile Appliances are designed to make daily life simpler by incorporating Smart Home technology and cutting-edge features in every appliance. GE Profile’s sleek design and quality engineering will give your kitchen the most up-to-date look and the best innovative performance you’ve been looking for.

Working very well with large loads of clothes, is quiet and easy to operate. Dw Jr. 2040 Evergreen Drive. Sat Jun 13 2026

Are you bothered by the fact that your clothes are always not dry or smelly in the wet weather? Then you need this clothes dryer. This avant-garde appliance not only alleviates the perils of clammy attire but also ushers in a new era of convenience and control. It is an embodiment of sophisticated technology coupled with practicality, designed to emancipate your wardrobe from the shackles of humidity.

No es muy buena. Anonymous. Thu Mar 26 2026

Built on the belief that modern life needs modern solutions, GE Profile Appliances are designed to make daily life simpler by incorporating Smart Home technology and cutting-edge features in every appliance. GE Profile’s sleek design and quality engineering will give your kitchen the most up-to-date look and the best innovative performance you’ve been looking for.

Huge capacity, great performance, energy saving efficiency with great features using amazing technology. Ge Dryer New 2026. Clearwater Fl. Fri Apr 10 2026

Samsungs Bespoke ultra capacity electric dryer has a sleek, flat-panel design, comes in new premium colors, and is equipped with smart features that simplify your laundry experience. It has our super-speed dry, which optimally dries a full load in just 30 minutes, and our AI smart dial, which learns and recommends your favorite cycles and makes controlling your dryer a breeze.

Beautiful set! Delivery guys were so helpful and professional. Pam. Wichita, KS. Sat Dec 14 2024

The GE pedestal for front-load laundry helps you keep your laundry supplies on hand for easy access. The pedestal helps to raise your washer or dryer to a convenient level, providing storage for detergents, fabric softeners, and other laundry aids.

Love these pedestal drawers. I will say that the initial one for the washer did not slide and glide and was replaced. The whole set is such a stunning set.. Brenda. US. Tue Feb 03 2026

This smart-enabled washer and dryer set, featuring front-load technology and a convenient Speed Wash cycle, redefines laundry day. Enjoy the benefits of a streamlined laundry experience with this innovative appliance duo, designed to seamlessly integrate into your modern lifestyle.

Beautiful set! Delivery guys were so helpful and professional. Pam. Wichita, KS. Sat Dec 14 2024

Built on the belief that modern life needs modern solutions, GE Profile Appliances are designed to make daily life simpler by incorporating Smart Home technology and cutting-edge features in every appliance. GE Profile’s sleek design and quality engineering will give your kitchen the most up-to-date look and the best innovative performance you’ve been looking for.

had to swap out to run with LP gas. broke ignitor in doing that. Replaced it and now it is excellent.. Mikessn. Toomsuba, MS. Sun Jun 07 2026

Built on the belief that modern life needs modern solutions. GE Profile Appliances are designed to make daily life simpler by incorporating Smart Home technology and cutting-edge features in every appliance. GE Profile's sleek design and quality engineering will give your kitchen the most up-to-date look and the best innovative performance you've been looking for.

Huge capacity, great performance, energy saving efficiency with great features using amazing technology. Ge Dryer New 2026. Clearwater Fl. Fri Apr 10 2026

Elevates your washer and dryer by more than a foot, for easier loading and unloading.

The green pedestals are gorgeous!!. Donna. San Antonio, TX. Sat Jan 18 2025

Meet the Ninja Blast Max - the performance of a corded blender now cord free. Blend, Twist & Go from virtually anywhere while powerfully blasting through ice and frozen fruit with Ninja blending power. Achieve pulsing and processing power through 3 new intelligent Auto IQ programs. Blend, crush and smoothie. Plus, with one simple twist you can remove the vessel for ultra portability, lighter carrying, and convenient sipping.

Love this blender! It makes delicious smoothies.. Kathryn. Havertown, PA. Wed Jul 01 2026

This fruit and vegetable cleaning machine can efficiently remove harmful residues and deep clean without harming the ingredients! It is lightweight and portable, so you can use it when you are traveling. With one-touch quick cleaning and extended freshness, you can enjoy every bite of peace of mind anytime, anywhere!

After fully charging the new product, it seemed to work well for 4-5 applications, but after the initial charge was used, it wouldn’t recharge, so I had to throw it away.. Douglas. Nyack, NY. Tue Jun 02 2026

A tubs and whirlpools will eliminate your worries all day or start a day full of vitality. This inflatable bath with a shower cover offers a warm and cozy bathing experience. Its inflatable design has greater flexibility, allowing it to be used in any space, and is easy to store. Such a comfortable, health-friendly, stress-reducing inflatable bathtub is an ideal gift for parents and friends. Pump Power: 30W. Suitable Weight: Less than 100kg/220lbs. Suitable Height: 1.8m/5.9ft. The number of layers: 4. Inflation Time: About 1 min. Heat resistant temperature: About 50 °C/122 °F. Product size: 84 x 140 x 74cm/33.07 x 55.11 x 29.13in. 36H Shipping.

It was great. Anonymous. Sun Feb 08 2026

Kitchen Four-Piece Toy Set: Including a toy kitchen, oven, refrigerator, and washing machine, each piece is meticulously designed to provide children with a comprehensive gaming experience and ignite their passion for life.

This is so cute! Really easy to assemble. The hardest part was the shelf above. I am already looking for my next toys!. Vicki. WI. Fri Jun 19 2026

The 24" unique classic retro built-in dishwasher transports you back to the '50s with its iconic retro design and chrome-finished accents. Extremely quiet, our unique dishwasher allows for continued cleaning while entertaining. Multiple wash cycles make clean-up easy for any small or large task! Create a unique classic retro kitchen with appliances from unique appliances!

My parents celebrated their 50th wedding anniversary so I gifted this to them. Its really cute and works well. My parents LOVED it!. Sara. Phoenix, AZ. Fri Feb 20 2026

Our mini garment rack can meet your travel needs, is small and Weight only 1.6 lbs, You can easily put it in your luggage, handbag or backpack. Suitable for business trip, travel, camping, RV, dance, laundry, hotel, dorm room, hiking.

Clothes Drying Rack, Drying Rack Clothing with Height-Adjustable, Foldable Gullwings Laundry Drying Rack, Indoor Outdoor Use, No Assembly

This is exactly what I wanted and needed (who knew!). After searching high and low and being disappointed at every turn. This stand is perfect! It is sturdy, stable and can handle a full load of towels, and sheets and does not wobble. It folds to be stored away when not needed. I like that for smaller loads I can use one wing and not both. or just smaller tent. It is wonderfully flexible.. Kirti. Arlington, MA. Wed May 20 2026

Enjoy smoothies on the go with this personal blender! Featuring a safety locking system and single-touch operation, this blender is perfect for whipping up your favorite blends. The convenient travel cup allows you to take your smoothie with you wherever you go.

Great portable blender. Rosemary. MI. Thu Jul 02 2026

Enjoy fresh smoothies or protein shakes anywhere with this portable personal blender. Its powerful battery and detachable blending mechanism make it perfect for on-the-go use.

Very convenient... just the right size. Works great.. Cheryl. US. Tue Feb 03 2026

This 4-piece washcloth set introduces a layer of utility to your daily routine, updating your space with straightforward simplicity. It's woven from cotton to create an absorbent surface that helps dry off moisture quickly. The double-stitched long sides reinforce the construction, giving each piece a neat edge that handles regular use. The low-twist weave delivers a soft feel on your skin while remaining a light and practical choice for your home. Plus, these washcloths are machine washable for quick, straightforward care whenever they need a refresh.

Bought to replace older washcloths. Thick and soft, and have lasted quite a while.. Heather. Ashland, VA. Fri Jul 10 2026

Made from aluminum with soft EVA grip, sturdy and comfortable to carry a full load hamper.600D oxford fabric with thickened PE coating inside for mositureproof.15"(L) x 15"(W) x 31"(H) / 38x38x79cm (includes handle), 90L large capacity.

TheCollapsiblePortableIndoorTripodClothesDryingRackistheperfectenvironmentallyfriendlyalternativefordryinglaundry.Thisthoughtfullydesignedindoorfoldingtripodhangingrackisdesignedtomakeairdryingyourclothesabreeze.Craftedwithasturdysteelframeandarms,thisrackprovidesamplestrengthandstabilitytoholdeventheheaviestofitemslikewettowelsandjeans.Itshangerslotscanaccommodatehangerplacementthroughandatoptheprovidedholes,ensuringyourclothesaredrywrinkle-free,andwithoutanymarks.Measuring64.5inchesHx26inchesindiameter,thisdryingrackprovidesamplespacefordryingafullloadoflaundry.Whennotinuse,itfoldsanddisassembleseasilytostoreinaclosetorsmallspace.Itssilverandbluecolorschemeaddsatouchofmodernstyletoyourspace,whileitscleverdesignmakesiteasytouseandmaintain.

This is wonderful! it is strong and I like that when I "line dry" my clothes, I place them on the hanger and just have to place them in the closet after they dried. Linda. Palm Coast, FL. Sat Jul 11 2026

Keeping things clean and organized on the go is easier than ever with the 9L collapsible sink basin by Wakeman Outdoors. This perfectly packable foldable bucket is only 2.87 inches tall when collapsed so it won’t add too much bulk to your camping gear, and the bottom has a convenient built-in drain that can be opened or closed with a simple twist. Use this plastic wash basin as a collapsible sink for washing dishes during camping trips, for hand-washing delicates, for cleaning produce, or as an easy way to keep your favorite drinks on ice while tailgating. Wakeman Outdoors is your go-to source for camping accessories that help you stay comfortable wherever adventure takes you.

This was a great size and will be so convenient to use in my farm style kitchen sink.. Lisa. Graford, TX. Tue Jul 07 2026

This portable camping hammock lets you relax and nap whether you're in your yard or on a family trip. Its foldable frame is crafted from steel and can be adjusted for both height and width. The hammock sling is crafted from polyester mesh for a breezy look and feel with run ribbon trim on either end near the ring and chain. We love that this hammock is rust-resistant for holding up to everyday use – or every night use after time around the fire together. It has a weight capacity of 300 lbs., and it comes with an included storage bag for easy transportation.

I can’t wait to take this camping! It is so comfortable and even for me, who is a big girl, and our dog too. Super sturdy but yet lightweight.. Kelly. Burlington, WA. Sat Jun 20 2026

Laundry storage springs to lifetime and time again with this Laundry Sorter from Whitmor! The Flexi-Frame quickly folds down for easy storage and pops back into its original shape when needed. This foldable feature makes it particularly useful for college dorms, camping, and small apartments, anywhere space is limited. The breathable mesh holds clothes safely while permitting air to circulate throughout the hamper eliminating moisture and typical laundry hamper odors. Two sturdy handles make the sorter easy to transport. Dimensions: 13.5 L x 31.75 W x 23.25 H inches.

Not 3-pack, I guess it's 3 compartments. Good quality overall.. Anonymous. US. Sat Sep 27 2025

BISSELL TurboClean upright carpet & upholstery cleaner provides a powerful clean on high-traffic areas, pet messes, and everyday tough ground-in dirt and stains in small spaces. Using powerful suction in combination with 4-Row DeepReach PowerBrush, even the most ground-in dirt and stains are removed. The removable nozzle allows for a quick and easy rinse to keep your machine working like new. It’s compact and lightweight figure was designed to seamlessly deep clean throughout your home and make storing easy. The BISSELL TurboClean upright carpet & upholstery cleaner comes with two 8oz formulas: PRO MAX Clean + Protect, our most powerful formula with StainProtect Technology, and Pet Pro OXY Urine Eliminator to remove tough pet stains & odors at the source with the power of OXY. Since 2011, BISSELL has donated over $26 million in support of BISSELL Pet Foundation. When you purchase a BISSELL product, you help save pets, too. Our products are engineered to clean even the toughest messes so pets can stay at home and out of shelters.

This carpet cleaner is the best hands down, i just turn my carpet from old to new. I highly recommend it. Rafael. Tue Feb 17 2026

Ironing boards are often fiddly to set up and difficult to store away. Pocket, however, breaks the mold. We designed our revolutionary table-top ironing board with exceptional storage capabilities and uncompromising functionality. When not in use, Pocket folds in half for easy storing and even has an integrated storage compartment for the iron.

Great quality. Just note that the design with the four legs isn’t practical unless you’re ironing flat items. You can’t wrap the item around the board. Lindsay. Lake Forest Park, WA. Thu Jan 22 2026